General Information

  • ID:  hor004434
  • Uniprot ID:  P41540
  • Protein name:  Substance P
  • Gene name:  Tac1
  • Organism:  Oryctolagus cuniculus (Rabbit)
  • Family:  Tachykinin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oryctolagus (genus), Leporidae (family), Lagomorpha (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007217 tachykinin receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission
  • GO CC:  GO:0005576 extracellular region; GO:0045202 synapse

Sequence Information

  • Sequence:  RPKPQQFFGLM
  • Length:  11(58-68)
  • Propeptide:  MKILVALAVLALVSTQLFAEDIRANDDLNYWSDWSDSDQIKEELPEPFEHLLQRIARRPKPQQFFGLMGKRDAGHGQISHKRHKTDSFVGLMGKRALNSVAYERSAMQNYERRRK
  • Signal peptide:  MKILVALAVLALVSTQLFA
  • Modification:  T11 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles
  • Mechanism:  NA
  • Cross BBB:  YES
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  2.1 (t1/2 of hydrolysis) minutes; /126 seconds ( PubMed ID: 7529108 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P41540-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004434_AF2.pdbhor004434_ESM.pdb

Physical Information

Mass: 152717 Formula: C63H97N17O14S
Absent amino acids: ACDEHINSTVWY Common amino acids: FPQ
pI: 11.65 Basic residues: 2
Polar residues: 1 Hydrophobic residues: 3
Hydrophobicity: -70 Boman Index: -1738
Half-Life / Aliphatic Index: 1 hour Aliphatic Index: 35.45
Instability Index: 4790.91 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  8363593##7529108
  • Title:  Nucleotide Sequence of the Rabbit Gamma-Preprotachykinin I cDNA